A5370
DBI Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5370
- Additional Names:
- ACBD1|ACBP|CCK-RP|DBI|EP
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 12 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
- Uniprot:
- P07108
- Synonyms:
- ACBD1;ACBP;acyl coenzyme A binding protein;acyl-CoA-binding protein;acyl-Coenzyme A binding domain containing 1;CCK-RP;cholecystokinin-releasing peptide, trypsin-sensitive;diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein);diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein);diazepam-binding inhibitor;endozepine;EP;epididymis secretory sperm binding protein;GABA receptor modulator
- Extra Details:
- This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice



_KO-WB_01.jpg)

