A5362
TCEB2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5362
- Additional Names:
- SIII|TCEB2
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
- Uniprot:
- Q15370
- Synonyms:
- elongin 18 kDa subunit;elongin-B;elongin, 18-kD subunit;epididymis secretory sperm binding protein;RNA polymerase II transcription factor SIII p18 subunit;RNA polymerase II transcription factor SIII subunit B;SIII;SIII p18;TCEB2;transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B);transcription elongation factor B polypeptide 2;transcription elongation factor B subunit 2
- Extra Details:
- This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13.
- Shipping Conditions:
- Blue Ice