A5360
Syntenin Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5360
- Additional Names:
- MDA-9|MDA9|ST1|SYCL|Syntenin|TACIP18
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILST
- Uniprot:
- O00560
- Synonyms:
- MDA-9;MDA9;melanoma differentiation associated protein-9;Melanoma differentiation-associated protein 9;pro-TGF-alpha cytoplasmic domain-interacting protein 18;scaffold protein Pbp1;ST1;SYCL;syndecan binding protein (syntenin);syndecan-binding protein 1;syntenin-1;TACIP18
- Extra Details:
- The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes.
- Shipping Conditions:
- Blue Ice