A5353
Myelin oligodendrocyte glycoprotein Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5353
- Additional Names:
- BTN6|BTNL11|MOGIG2|Myelin oligodendrocyte glycoprotein|NRCLP7
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
- Uniprot:
- Q16653
- Synonyms:
- BTN6;BTNL11;MOG alpha-5;MOG AluA;MOG AluB;MOG Ig-AluB;MOGIG2;myelin-oligodendrocyte glycoprotein;NRCLP7
- Extra Details:
- The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice