SLC4A4 / NBC Rabbit polyclonal antibody

Size

£152.00

SKU:: A5332
Additional Names:: hhNMC|HNBC1|KNBC|kNBC1|NBC1|NBC2|NBCe1|NBCe1-A|pNBC|SLC4A4 / NBC|SLC4A5
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 135kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
Uniprot:: Q9Y6R1
Synonyms:: electrogenic sodium bicarbonate cotransporter 1;hhNMC;HNBC1;KNBC;kNBC1;Na(+)/HCO3(-) cotransporter;NBC1;NBC2;NBCe1-A;pNBC;SLC4A5;sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney; sodium bicarbonate cotransporter, pancreas);solute carrier family 4 (sodium bicarbonate cotransporter), member 4;Solute carrier family 4 member 4;solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type;solute carrier family 4, sodium bicarbonate cotransporter, member 5
Extra Details:: This gene encodes a sodium bicarbonate cotransporter (NBC) involved in the regulation of bicarbonate secretion and absorption and intracellular pH. Mutations in this gene are associated with proximal renal tubular acidosis. Multiple transcript variants encoding different isoforms have been found for this gene.