S100A12 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5328
Additional Names:: CAAF1|CAGC|CGRP|ENRAGE|MRP-6|MRP6|p6|S100A12
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 11kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Uniprot:: P80511
Synonyms:: CAAF1;CAGC;calcitermin;calcium-binding protein in amniotic fluid 1;calgranulin C;Calgranulin-C;CGRP;EN-RAGE;ENRAGE;extracellular newly identified RAGE-binding protein;migration inhibitory factor-related protein 6;MRP-6;MRP6;neutrophil S100 protein;p6;protein S100-A12;S100 calcium-binding protein A12
Extra Details:: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.

Shipping Conditions:: Blue Ice