PKA C-beta (PRKACB) Rabbit polyclonal antibody

Size

£152.00

SKU:: A5324
Additional Names:: CAFD2|PKA C-beta|PKA C-beta (PRKACB)|PKACB
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 46kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
Uniprot:: P22694
Synonyms:: CAFD2;cAMP-dependent protein kinase catalytic subunit beta;PKA C-beta;PKACB;protein kinase A catalytic subunit beta;protein kinase, cAMP-dependent, beta catalytic subunit;protein kinase, cAMP-dependent, catalytic, beta
Extra Details:: The protein encoded by this gene is a member of the serine/threonine protein kinase family. The encoded protein is a catalytic subunit of cAMP (cyclic AMP)-dependent protein kinase, which mediates signalling though cAMP. cAMP signaling is important to a number of processes, including cell proliferaton and differentiation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.