A5322
PIAS4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5322
- Additional Names:
- PIAS-gamma|PIAS4|Piasg|PIASY|ZMIZ6
- Application:
- ELISA, WB
- Molecular Weight:
- 57-75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ELYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITV
- Uniprot:
- Q8N2W9
- Synonyms:
- E3 SUMO-protein ligase PIAS4;PIAS-gamma;Piasg;PIASY;protein inhibitor of activated STAT protein 4;protein inhibitor of activated STAT protein gamma;protein inhibitor of activated STAT protein PIASy;RING-type E3 ubiquitin transferase PIAS4;zinc finger, MIZ-type containing 6;ZMIZ6
- Extra Details:
- Enables SUMO ligase activity and ubiquitin protein ligase binding activity. Involved in negative regulation of transcription, DNA-templated; positive regulation of protein sumoylation; and protein sumoylation. Located in cytoplasm and nucleus.
- Shipping Conditions:
- Blue Ice