A5319
NDRG2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5319
- Additional Names:
- NDRG2|SYLD
- Application:
- ELISA, WB
- Molecular Weight:
- 36kDa/41kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC
- Uniprot:
- Q9UN36
- Synonyms:
- cytoplasmic protein Ndr1;N-myc downstream regulator 2;N-myc downstream-regulated gene 2 protein;NDR1-related protein NDR2;protein NDRG2;Protein Syld709613;SYLD;syld709613 protein
- Extra Details:
- This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice