CAMK4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5304
Additional Names:: caMK|CaMK IV|CaMK-GR|CAMK4|CaMKIV
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Uniprot:: Q16566
Synonyms:: brain Ca(2+)-calmodulin-dependent protein kinase type IV;brain Ca++-calmodulin-dependent protein kinase type IV;calcium/calmodulin-dependent protein kinase type IV;calcium/calmodulin-dependent protein kinase type IV catalytic chain;CAM kinase IV;CAM kinase- GR;CaM kinase-GR;caMK;CaMK IV;CaMK-GR;CaMKIV
Extra Details:: The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.