Snail Rabbit polyclonal antibody

Size

£152.00

SKU:: A5243
Additional Names:: dJ710H13.1|SLUGH2|SNA|SNAH|SNAIL|SNAIL1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 29kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Uniprot:: O95863
Synonyms:: dJ710H13.1;protein sna;protein snail homolog 1;SLUGH2;SNA;SNAH;SNAIL;snail 1 homolog;snail 1 zinc finger protein;snail family zinc finger 1;snail homolog 1;SNAIL1;zinc finger protein SNAI1
Extra Details:: The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.