GSTK1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5226
Additional Names:: GST|GST 13-13|GST13|GST13-13|GSTK1|GSTK1-1|hGSTK1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Uniprot:: Q9Y2Q3
Synonyms:: glutathione S-transferase k1;glutathione S-transferase kappa 1;Glutathione S-transferase subunit 13;glutathione S-transferase subunit 13 homolog;GST;GST 13-13;GST class-kappa;GST13;GST13-13;GSTK1-1;hGSTK1
Extra Details:: This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.