A5218
TEAD1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A5218
- Additional Names:
- AA|NTEF-1|REF1|TCF-13|TCF13|TEAD-1|TEAD1|TEF-1
- Application:
- ChIP, ELISA, WB, IP, FuncS
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR
- Uniprot:
- P28347
- Synonyms:
- AA;NTEF-1;protein GT-IIC;REF1;TCF-13;TCF13;TEA domain family member 1;TEA domain family member 1 (SV40 transcriptional enhancer factor);TEAD-1;TEF-1;transcription factor 13;transcriptional enhancer factor 1;transcriptional enhancer factor TEF-1
- Extra Details:
- This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
- Shipping Conditions:
- Blue Ice