A5207
BGAT Rabbit monoclonal antibody
Size
POA
- SKU:
- A5207
- Additional Names:
- A3GALNT|A3GALT1|BGAT|GTB|NAGAT
- Application:
- ELISA, WB
- Molecular Weight:
- 41kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTF
- Uniprot:
- P16442
- Synonyms:
- A3GALNT;A3GALT1;ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase);B(A) alpha-1,3-galactosyltransferase;Fucosylglycoprotein 3-alpha-galactosyltransferase;Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase;Glycoprotein-fucosylgalactoside alpha-galactosyltransferase;Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase;GTB;Histo-blood group A transferase;histo-blood group A2 transferase;histo-blood group ABO system transferase;Histo-blood group B transferase;NAGAT
- Extra Details:
- This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.
- Shipping Conditions:
- Blue Ice