A5191
DHX36 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5191
- Additional Names:
- DDX36|DHX36|G4R1|MLEL1|RHAU
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 114kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIV
- Uniprot:
- Q9H2U1
- Synonyms:
- ATP-dependent DNA/RNA helicase DHX36;ATP-dependent RNA helicase DHX36;DDX36;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36;DEAD/H box polypeptide 36;DEAH (Asp-Glu-Ala-His) box polypeptide 36;DEAH box protein 36;G4 resolvase-1;G4-resolvase 1;G4R1;MLE-like protein 1;MLEL1;probable ATP-dependent RNA helicase DHX36;RHAU;RNA helicase associated with AU-rich element ARE;RNA helicase associated with AU-rich element protein
- Extra Details:
- This gene is a member of the DEAH-box family of RNA-dependent NTPases which are named after the conserved amino acid sequence Asp-Glu-Ala-His in motif II. The protein encoded by this gene has been shown to enhance the deadenylation and decay of mRNAs with 3'-UTR AU-rich elements (ARE-mRNA). The protein has also been shown to resolve into single strands the highly stable tetramolecular DNA configuration (G4) that can form spontaneously in guanine-rich regions of DNA. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice