A5173
Thromboxane synthase Rabbit monoclonal antibody

Size
POA
- SKU:
- A5173
- Additional Names:
- BDPLT14|CYP5|CYP5A1|GHOSAL|THAS|Thromboxane synthase|TS|TXAS|TXS
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVL
- Uniprot:
- P24557
- Synonyms:
- BDPLT14;CYP5;CYP5A1;cytochrome P450 5A1;cytochrome P450, family 5, subfamily A, polypeptide 1;GHOSAL;hydroperoxy icosatetraenoate dehydratase;platelet, cytochrome P450, subfamily V;THAS;thromboxane A synthase 1 (platelet);thromboxane-A synthase;TS;TXA synthase;TXAS;TXS
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

