A5103
PAR2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A5103
- Additional Names:
- GPR11|PAR2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
- Uniprot:
- P55085
- Synonyms:
- coagulation factor II (thrombin) receptor-like 1;Coagulation factor II receptor-like 1;G-protein coupled receptor 11;GPR11;PAR2;protease-activated receptor 2;proteinase-activated receptor 2;thrombin receptor-like 1
- Extra Details:
- This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered ligand that binds to an extracellular loop domain. Activation of the receptor has been shown to stimulate vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. This protein is also important in the inflammatory response, as well as innate and adaptive immunity.
- Shipping Conditions:
- Blue Ice