[KO Validated] ATPIF1 Rabbit polyclonal antibody

Size

POA

SKU:: A5099
Additional Names:: ATPI|ATPIF1|ATPIP|F1|IP
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
Uniprot:: Q9UII2
Synonyms:: ATP synthase F1 subunit epsilon;ATP synthase inhibitor protein;ATPase inhibitor protein;ATPase inhibitor, mitochondrial;ATPase inhibitory factor 1;ATPI;ATPIF1;ATPIP;IF(1);IF1;inhibitor of F(1)F(o)-ATPase;IP
Extra Details:: Enables several functions, including ATPase binding activity; angiostatin binding activity; and mitochondrial proton-transporting ATP synthase complex binding activity. Involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Located in cell surface and mitochondrion.