A5094
PSMA3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A5094
- Additional Names:
- HC8|PSC3|PSMA3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 21-150 of human PSMA3 (P25788).
- Formulation:
- Unmodified
- Sequence:
- VFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLY
- Uniprot:
- P25788
- Synonyms:
- HC8;macropain subunit C8;multicatalytic endopeptidase complex subunit C8;proteasome (prosome, macropain) subunit, alpha type, 3;proteasome component C8;proteasome subunit alpha 3;proteasome subunit alpha type-3;proteasome subunit alpha7;proteasome subunit C8;PSC3;testicular secretory protein Li 43
- Extra Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice