A5077
GFM1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5077
- Additional Names:
- COXPD1|EFG|EFG1|EFGM|EGF1|GFM|GFM1|hEFG1|mtEF-G1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 85kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKPKVAFRETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN
- Uniprot:
- Q96RP9
- Synonyms:
- COXPD1;EFG;EFG1;EFGM;EGF1;Elongation factor G 1, mitochondrial;elongation factor G, mitochondrial;Elongation factor G1;G translation elongation factor, mitochondrial;GFM;hEFG1;mitochondrial elongation factor G;mitochondrial elongation factor G1;mtEF-G1
- Extra Details:
- Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known.
- Shipping Conditions:
- Blue Ice