EEA1 Rabbit monoclonal antibody

Size

POA

SKU:: A5057
Additional Names:: EEA1|MST105|MSTP105|ZFYVE2
Application:: ELISA, WB
Molecular Weight:: 170kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLK
Uniprot:: Q15075
Synonyms:: early endosome antigen 1;early endosome antigen 1, 162kD;early endosome-associated protein;endosome-associated protein p162;MST105;MSTP105;ZFYVE2;zinc finger FYVE domain-containing protein 2
Extra Details:: Enables 1-phosphatidylinositol binding activity; GTP-dependent protein binding activity; and protein homodimerization activity. Involved in endocytosis; vesicle fusion; and viral RNA genome replication. Located in cytosol and early endosome. Is extrinsic component of plasma membrane.