A5000
CDK5RAP3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5000
- Additional Names:
- C53|CDK5RAP3|HSF-27|IC53|LZAP|MST016|OK/SW-cl.114|PP1553
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES
- Uniprot:
- Q96JB5
- Synonyms:
- C53;CDK5 activator-binding protein C53;CDK5 regulatory subunit associated protein IC53-2;CDK5 regulatory subunit-associated protein 3;HSF-27;IC53;ischemic heart CDK5 activator-binding protein C53;LXXLL/leucine-zipper-containing ARF-binding protein;LXXLL/leucine-zipper-containing ARFbinding protein;LZAP;MST016;OK/SW-cl.114;PP1553;Protein HSF-27
- Extra Details:
- This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms.
- Shipping Conditions:
- Blue Ice

