LPCAT1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4987
Additional Names:: AGPAT10|AGPAT9|AYTL2|lpcat|LPCAT-1|LPCAT1|LPLAT8|lysoPAFAT|PFAAP3
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 59kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Uniprot:: Q8NF37
Synonyms:: 1-acylglycerol-3-phosphate O-acyltransferase;1-acylglycerophosphocholine O-acyltransferase;1-alkenylglycerophosphocholine O-acyltransferase;1-alkylglycerophosphocholine O-acetyltransferase;acetyl-CoA:lyso-PAF acetyltransferase;acetyl-CoA:lyso-platelet-activating factor acetyltransferase;acyltransferase-like 2;AGPAT10;AGPAT9;AYTL2;LPC acyltransferase 1;lpcat;LPCAT-1;lyso-PAF acetyltransferase;lysoPAFAT;lysoPC acyltransferase 1;lysophosphatidylcholine acyltransferase 1;PFAAP3;phosphonoformate immuno-associated protein 3
Extra Details:: This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor (PAF). Elevated expression of this gene may contribute to the progression of oral squamous cell, prostate, breast, and other human cancers.

Shipping Conditions:: Blue Ice