NMNAT1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4937
Additional Names:: LCA9|NMNAT|NMNAT1|PNAT1|SHILCA
Application:: ELISA, WB
Molecular Weight:: 29kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPK
Uniprot:: Q9HAN9
Synonyms:: LCA9;NaMN adenylyltransferase 1;nicotinamide mononucleotide adenylyltransferase 1;Nicotinamide-nucleotide adenylyltransferase 1;nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1;nicotinate-nucleotide adenylyltransferase 1;NMN adenylyltransferase 1;NMN/NaMN adenylyltransferase 1;NMNAT;PNAT1;pyridine nucleotide adenylyltransferase 1;SHILCA
Extra Details:: This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15.

Shipping Conditions:: Blue Ice