A4902
CADM3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4902
- Additional Names:
- BIgR|CADM3|CMT2FF|IGSF4B|Necl-1|NECL1|synCAM3|TSLL1
- Application:
- ELISA, WB
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
- Uniprot:
- Q8N126
- Synonyms:
- BIgR;brain immunoglobulin receptor;cell adhesion molecule 3;CMT2FF;IGSF4B;immunoglobulin superfamily member 4B;Necl-1;NECL1;Nectin-like protein 1;synaptic cell adhesion molecule 3;synCAM3;TSLC1-like 1;TSLC1-like protein 1;TSLL1
- Extra Details:
- The protein encoded by this gene is a calcium-independent cell-cell adhesion protein that can form homodimers or heterodimers with other nectin proteins. The encoded protein has both homophilic and heterophilic cell-cell adhesion activity. This gene is reported to be a tumor suppressor gene.
- Shipping Conditions:
- Blue Ice