A4899
alpha + beta Synuclein Rabbit monoclonal antibody
Size
POA
- SKU:
- A4899
- Additional Names:
- alpha + beta Synuclein|NACP|PARK1|PARK4|PD1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL
- Uniprot:
- P37840, Q16143
- Synonyms:
- alpha-synuclein;beta-synuclein;I(2)-synuclein;I+/--synuclein;NACP;non A-beta component of AD amyloid;Non-A beta component of AD amyloid;Non-A4 component of amyloid precursor;PARK1;PARK4;PD1;synuclein alpha-140;synuclein, alpha (non A4 component of amyloid precursor);truncated alpha synuclein
- Extra Details:
- Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]
- Shipping Conditions:
- Blue Ice