Caspase-2 Rabbit monoclonal antibody

Size

POA

SKU:: A4888
Additional Names:: CASP-2|Caspase-2|ICH1|NEDD-2|NEDD2|PPP1R57
Application:: ELISA, WB
Molecular Weight:: 14kDa/48kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GKNHTQSPGCEESDAGKEELMKMRLPTRSDMICGYACLKGNAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKEREGYAPGTEFHRCKEMSEYCSTLCQQLYLFPGYPPT
Uniprot:: P42575
Synonyms:: CASP-2;caspase 2 apoptosis-related cysteine peptidase;caspase-2;ICH1;NEDD-2;NEDD2;neural precursor cell expressed developmentally down-regulated protein 2;PPP1R57;protease ICH-1;protein phosphatase 1, regulatory subunit 57
Extra Details:: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.