A4861
Cyclophilin B Rabbit monoclonal antibody
Size
POA
- SKU:
- A4861
- Additional Names:
- Cyclophilin B|CYP-S1|CYPB|HEL-S-39|OI9|SCYLP
- Application:
- ELISA, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIA
- Uniprot:
- P23284
- Synonyms:
- B;Cyclophilin B;cyclophilin-like protein;CYP-S1;CYPB;epididymis secretory protein Li 39;HEL-S-39;OI9;peptidyl-prolyl cis-trans isomerase B;peptidylprolyl isomerase B (cyclophilin B);PPIase B;rotamase B;S-cyclophilin;SCYLP
- Extra Details:
- The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta.
- Shipping Conditions:
- Blue Ice