A4860
PI3 Kinase p85 beta Rabbit monoclonal antibody
Size
POA
- SKU:
- A4860
- Additional Names:
- MPPH|MPPH1|p85|p85-BETA|P85B|p85beta|PI3 Kinase p85 beta
- Application:
- ELISA, WB
- Molecular Weight:
- 85kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE
- Uniprot:
- O00459
- Synonyms:
- MPPH;MPPH1;p85;p85-BETA;P85B;phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;phosphatidylinositol 3-kinase regulatory subunit beta;phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta);phosphoinositide-3-kinase regulatory subunit beta;phosphoinositide-3-kinase, regulatory subunit 2 (beta);PI3-kinase subunit p85-beta;PI3K regulatory subunit beta;ptdIns-3-kinase regulatory subunit p85-beta
- Extra Details:
- Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subunit. The protein encoded by this gene is a regulatory component of PI3K. Three transcript variants, one protein coding and the other two non-protein coding, have been found for this gene.
- Shipping Conditions:
- Blue Ice