Histone H3.3 Rabbit monoclonal antibody

Size

POA

SKU:: A4835
Additional Names:: BRYLIB1|H3-3B|H3.3A|H3F3|H3F3A|Histone H3.3
Application:: ChIP, ELISA, WB, IHC-P
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Uniprot:: P84243
Synonyms:: H3 histone family member 3A;H3 histone family member 3B;H3 histone, family 3A;H3 histone, family 3B (H3.3B);H3-3A;H3-3B;H3.3A;H3.3B;H3F3;H3F3A;H3F3B;histone H3.3
Extra Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded is a replication-independent member of the histone H3 family.