A4831
PIDD Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4831
- Additional Names:
- LRDD|MRT75|PIDD
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 100-110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQL
- Uniprot:
- Q9HB75
- Synonyms:
- leucine-rich repeat and death domain-containing protein;leucine-rich repeats and death domain containing;LRDD;p53-induced death domain-containing protein 1;p53-induced protein with a death domain;PIDD
- Extra Details:
- The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice