A4808
Collagen XVII/COL17A1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A4808
- Additional Names:
- BA16H23.2|BP180|BPA-2|BPAG2|Collagen XVII/COL17A1|ERED|JEB4|LAD-1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 150-180kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGP
- Uniprot:
- Q9UMD9
- Synonyms:
- 180 kDa bullous pemphigoid antigen 2;alpha 1 type XVII collagen;BA16H23.2;bA16H23.2 (collagen, type XVII, alpha 1 (BP180));BP180;BPA-2;BPAG2;Bullous pemphigoid antigen 2;bullous pemphigoid antigen 2 (180kD);collagen alpha-1(XVII) chain;collagen XVII, alpha-1 polypeptide;collagen, type XVII, alpha 1;ERED;LAD-1;type XVII collagen alpha-1
- Extra Details:
- This gene encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form.
- Shipping Conditions:
- Blue Ice