A4800
CC2D1A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A4800
- Additional Names:
- Aki-1|CC2D1A|FREUD-1|Freud-1/Aki1|Lgd2|MRT3|TAPE
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 131kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTA
- Uniprot:
- Q6P1N0
- Synonyms:
- Aki-1;Akt kinase-interacting protein 1;coiled-coil and C2 domain-containing protein 1A;five prime repressor element under dual repression-binding protein 1;five repressor element under dual repression-binding protein 1;FRE under dual repression-binding protein 1;FREUD-1;Freud-1/Aki1;Lgd2;MRT3;putative NF-kappa-B-activating protein 023N;putative NFkB activating protein;TAPE;TBK1-associated protein in endolysosomes
- Extra Details:
- This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5'-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in a nonsyndromic form of cognitive disability (MRT3).
- Shipping Conditions:
- Blue Ice





