A4784
RNF20 Rabbit monoclonal antibody

Size
POA
- SKU:
- A4784
- Additional Names:
- BRE1|BRE1A|hBRE1|RNF20
- Application:
- ELISA, WB
- Molecular Weight:
- 120kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGIGNKRAAGEPGTSMPPEKKAAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAEMLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQF
- Uniprot:
- Q5VTR2
- Synonyms:
- BRE1;BRE1 E3 ubiquitin ligase homolog;BRE1A;E3 ubiquitin-protein ligase BRE1A;hBRE1;homolog of S. cerevisiae BRE1;RING finger protein 20;RING-type E3 ubiquitin transferase BRE1A
- Extra Details:
- The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. The protein encoded by this human gene is an E3 ubiquitin ligase that regulates chromosome structure by monoubiquitinating histone H2B. This protein acts as a putative tumor suppressor and positively regulates the p53 tumor suppressor as well as numerous histone H2A and H2B genes. In contrast, this protein also suppresses the expression of several protooncogenes and growth-related genes, including many genes that are induced by epidermal growth factor. This gene selectively suppresses the expression of some genes by interfering with chromatin recruitment of transcription elongation factor SII (TFIIS).
- Shipping Conditions:
- Blue Ice



