A4778
NANS Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4778
- Additional Names:
- HEL-S-100|NANS|SAS|SEMDCG|SEMDG
- Application:
- ELISA, WB
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
- Uniprot:
- Q9NR45
- Synonyms:
- epididymis secretory protein Li 100;HEL-S-100;N-acetylneuraminate synthase;N-acetylneuraminate-9-phosphate synthase;N-acetylneuraminic acid phosphate synthase;N-acetylneuraminic acid synthase;SAS;SEMDCG;SEMDG;sialic acid phosphate synthase;sialic acid synthase
- Extra Details:
- This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant.
- Shipping Conditions:
- Blue Ice