A4765
Cytokeratin 7 (KRT7) Rabbit monoclonal antibody
Size
POA
- SKU:
- A4765
- Additional Names:
- CK7|Cytokeratin 7 (KRT7)|K2C7|K7|SCL
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN
- Uniprot:
- P08729
- Synonyms:
- CK-7;CK7;cytokeratin 7;Cytokeratin-7;K2C7;K7;keratin 7, type II;Keratin-7;keratin, 55K type II cytoskeletal;keratin, simple epithelial type I, K7;keratin, type II cytoskeletal 7;sarcolectin;SCL;type II mesothelial keratin K7;type-II keratin Kb7
- Extra Details:
- The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.
- Shipping Conditions:
- Blue Ice