A4735
KRAS+HRAS+NRAS Rabbit monoclonal antibody
Size
POA
- SKU:
- A4735
- Additional Names:
- ALPS4|CMNS|KRAS|KRAS+HRAS+NRAS|N-ras|NCMS|NRAS1|NS6
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 21kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQI
- Uniprot:
- P01111, P01112, P01116_
- Synonyms:
- 'C-K-RAS;ALPS4;C-BAS/HAS;C-H-RAS;C-HA-RAS1;c-has/bas p21 protein;C-K-RAS;c-Ki-ras;c-Ki-ras2;c-Kirsten-ras protein;cellular c-Ki-ras2 proto-oncogene;cellular transforming proto-oncogene;CFC2;CMNS;CTLO;GTP- and GDP-binding peptide B;GTPase HRas;GTPase KRas;GTPase NRas;H-Ras-1;H-RASIDX;Ha-Ras;Ha-Ras1 proto-oncoprotein;HAMSV;Harvey rat sarcoma viral oncogene homolog;Harvey rat sarcoma viral oncoprotein;HRAS1;K-Ras;K-Ras 2;K-ras p21 protein;K-RAS2A;K-RAS2B;K-RAS4A;K-RAS4B;KI-RAS;Kirsten rat sarcoma viral oncogene homolog;Kirsten rat sarcoma viral proto-oncogene;KRAS1;KRAS2;N-ras;N-ras protein part 4;NCMS;neuroblastoma RAS viral (v-ras) oncogene homolog;neuroblastoma RAS viral oncogene homolog;NRAS1;NS;NS3;NS6;OES;oncogene KRAS2;p19 H-RasIDX protein;p21ras;PR310 c-K-ras oncogene;RALD;Ras family small GTP binding protein H-Ras;RASH1;RASK2;transformation gene: oncogene HAMSV;transforming protein N-Ras;transforming protein p21;v-Ha-ras Harvey rat sarcoma viral oncogene homolog;v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog;v-ras neuroblastoma RAS viral oncogene homolog
- Extra Details:
- This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia.
- Shipping Conditions:
- Blue Ice