BMAL1 Rabbit monoclonal antibody

Size

POA

SKU:: A4714
Additional Names:: ARNTL|ARNTL1|bHLHe5|BMAL1|BMAL1c|JAP3|MOP3|PASD3|TIC
Application:: ELISA, WB
Molecular Weight:: 78kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
Uniprot:: O00327
Synonyms:: ARNT-like protein 1, brain and muscle;aryl hydrocarbon receptor nuclear translocator-like protein 1;basic helix-loop-helix family member e5;basic-helix-loop-helix-PAS orphan MOP3;basic-helix-loop-helix-PAS protein MOP3;bHLH-PAS protein JAP3;bHLHe5;BMAL1;BMAL1c;brain and muscle ARNT-like 1;class E basic helix-loop-helix protein 5;JAP3;member of PAS protein 3;member of PAS superfamily 3;MOP3;PAS domain containing 3;PAS domain-containing protein 3;PASD3;testis tissue sperm-binding protein Li 50e;TIC
Extra Details:: The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. The protein regulates interferon-stimulated gene expression and is an important factor in viral infection, including COVID-19.

Shipping Conditions:: Blue Ice