A4660
MRPS28 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4660
- Additional Names:
- COXPD47|HSPC007|MRP-S28|MRP-S35|MRPS28|MRPS35
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 21kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
- Uniprot:
- Q9Y2Q9
- Synonyms:
- 28S ribosomal protein S28, mitochondrial;28S ribosomal protein S35, mitochondrial;COXPD47;HSPC007;mitochondrial 28S ribosomal protein S35;mitochondrial small ribosomal subunit protein bS1m;MRP-S28;MRP-S35;MRPS35;S28mt;S35mt
- Extra Details:
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature.
- Shipping Conditions:
- Blue Ice