TIMM10 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4626
Additional Names:: TIM10|TIM10A|TIMM10|TIMM10A
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Uniprot:: P62072
Synonyms:: mitochondrial import inner membrane translocase subunit Tim10;TIM10;TIM10A;TIMM10A;translocase of inner mitochondrial membrane 10 homolog
Extra Details:: The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins.