BLOC1S6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4620
Additional Names:: BLOC1S6|BLOS6|HPS9|PA|PALLID|PLDN
Application:: ELISA, WB
Molecular Weight:: 20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK
Uniprot:: Q9UL45
Synonyms:: biogenesis of lysosomal organelles complex-1, subunit 5, pallidin;biogenesis of lysosomal organelles complex-1, subunit 6, pallidin;biogenesis of lysosome-related organelles complex 1 subunit 6;BLOC-1 subunit 6;BLOC-1 subunit pallidin;BLOS6;HPS9;PA;PALLID;pallid protein homolog;Pallidin;PLDN;syntaxin 13 binding protein 1;Syntaxin 13-interacting protein;syntaxin 13-interacting protein pallid
Extra Details:: The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.