A4592
TFF3 Rabbit monoclonal antibody

Size
POA
- SKU:
- A4592
- Additional Names:
- ITF|P1B|TFF3|TFI
- Application:
- ELISA, IHC-P
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
- Uniprot:
- Q07654
- Synonyms:
- Intestinal trefoil factor;ITF;P1B;polypeptide P1.B;TFI;trefoil factor 3;trefoil factor 3 (intestinal)
- Extra Details:
- Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
- Shipping Conditions:
- Blue Ice





