A4590
MOB4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A4590
- Additional Names:
- 2C4D|CGI-95|MOB1|MOB3|MOB4|MOBKL3|PHOCN|PREI3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
- Uniprot:
- Q9Y3A3
- Synonyms:
- 2C4D;CGI-95;class II mMOB1;MOB-like protein phocein;MOB1;mob1 homolog 3;MOB1, Mps One Binder kinase activator-like 3;MOB3;MOBKL3;Mps One Binder kinase activator-like 3;phocein, Mob-like protein;PHOCN;PREI3;preimplantation protein 3
- Extra Details:
- This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.
- Shipping Conditions:
- Blue Ice





