SLC39A6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A4584
Additional Names:: LIV-1|LIV1|SLC39A6|ZIP6
Application:: ELISA, WB
Molecular Weight:: 102kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATL
Uniprot:: Q13433
Synonyms:: estrogen-regulated protein LIV-1;LIV-1;LIV-1 protein, estrogen regulated;LIV1;solute carrier family 39 (metal ion transporter), member 6;solute carrier family 39 (zinc transporter), member 6;Solute carrier family 39 member 6;zinc transporter ZIP6;ZIP-6;ZIP6;zrt- and Irt-like protein 6
Extra Details:: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).