PRPF8 Rabbit monoclonal antibody

Size

POA

SKU:: A4575
Additional Names:: HPRP8|PRP8|PRPC8|PRPF8|RP13|SNRNP220
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 274kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA
Uniprot:: Q6P2Q9
Synonyms:: 220 kDa U5 snRNP-specific protein;apoptosis-regulated protein 1;apoptosis-regulated protein 2;HPRP8;p220;pre-mRNA-processing-splicing factor 8;precursor mRNA processing protein;PRP8;PRP8 homolog;PRP8 pre-mRNA processing factor 8 homolog;PRPC8;RP13;SNRNP220;splicing factor Prp8;U5 snRNP-specific protein (220 kD), ortholog of S. cerevisiae Prp8p
Extra Details:: Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa.