A4565
GTPBP4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A4565
- Additional Names:
- CRFG|GTPBP4|NGB|NOG1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 74kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR
- Uniprot:
- Q9BZE4
- Synonyms:
- chronic renal failure gene protein;CRFG;G protein-binding protein CRFG;GTP-binding protein 4;GTP-binding protein NGB;NGB;NOG1;nucleolar GTP-binding protein 1
- Extra Details:
- GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.
- Shipping Conditions:
- Blue Ice






_IHC_01.jpg)
_IHC_02.jpg)
_IHC_03.jpg)