DHX9/RNA Helicase A Rabbit monoclonal antibody

Size

POA

SKU:: A4563
Additional Names:: DDX9|DHX9/RNA Helicase A|LKP|NDH2|NDHII|RHA
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 141kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
Uniprot:: Q08211
Synonyms:: ATP-dependent RNA helicase A;DDX9;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9;DEAH (Asp-Glu-Ala-His) box helicase 9;DEAH (Asp-Glu-Ala-His) box polypeptide 9;DEAH box protein 9;DEAH-box helicase 9;DExH-box helicase 9;leukophysin;LKP;NDH2;NDHII;nuclear DNA helicase II;RHA;RNA helicase A
Extra Details:: This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.