A4543
LARP1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A4543
- Additional Names:
- Lar1|LARP|LARP1|Lhp1
- Application:
- ELISA, WB
- Molecular Weight:
- 163kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD
- Uniprot:
- Q6PKG0
- Synonyms:
- La ribonucleoprotein domain family member 1;la-related protein 1;Lar1;LARP;Lhp1
- Extra Details:
- Enables eukaryotic initiation factor 4E binding activity; nucleic acid binding activity; and ribosomal small subunit binding activity. Involved in several processes, including TORC1 signaling; cellular response to rapamycin; and posttranscriptional regulation of gene expression. Located in cytoplasmic stress granule. Colocalizes with TORC1 complex and polysomal ribosome.
- Shipping Conditions:
- Blue Ice