A4482
NUDT21 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A4482
- Additional Names:
- CFIM25|CPSF5|NUDT21
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
- Uniprot:
- O43809
- Synonyms:
- CFIM25;cleavage and polyadenylation specific factor 5, 25 kD subunit;cleavage and polyadenylation specific factor 5, 25 kDa;cleavage and polyadenylation specificity factor 25 kDa subunit;cleavage and polyadenylation specificity factor subunit 5;cleavage factor Im complex 25 kDa subunit;CPSF 25 kDa subunit;CPSF5;nucleoside diphosphate-linked moiety X motif 21;nudix (nucleoside diphosphate linked moiety X)-type motif 21;Nudix hydrolase 21;nudix motif 21;pre-mRNA cleavage factor Im (25kD);pre-mRNA cleavage factor Im 25 kDa subunit;pre-mRNA cleavage factor Im 68 kDa subunit;pre-mRNA cleavage factor Im, 25kD subunit
- Extra Details:
- The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
