A4473
LEF1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A4473
- Additional Names:
- LEF-1|LEF1|TCF10|TCF1ALPHA|TCF7L3
- Application:
- ELISA, WB
- Molecular Weight:
- 25-58kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHA
- Uniprot:
- Q9UJU2
- Synonyms:
- LEF-1;lymphoid enhancer-binding factor 1;T cell-specific transcription factor 1-alpha;TCF1-alpha;TCF10;TCF1ALPHA;TCF7L3
- Extra Details:
- This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

